Chronic Hepatitis B in Asymptomatic Homosexual Men with Antibody to the Human Immunodeficiency Virus

Brief Reports1 September 1986Chronic Hepatitis B in Asymptomatic Homosexual Men with Antibody to the Human Immunodeficiency VirusROBERT P. PERRILLO, M.D., FREDRIC G. REGENSTEIN, M.D., STANFORD T. ROODMAN, Ph.D.ROBERT P. PERRILLO, M.D., FREDRIC G. REGENSTEIN, M.D., STANFORD T. ROODMAN, Ph.D.Author, Article, and Disclosure Informationhttps://doi.org/10.7326/0003-4819-105-3-382 SectionsAboutPDF ToolsAdd to favoritesDownload CitationsTrack CitationsPermissions ShareFacebookTwitterLinkedInRedditEmail ExcerptThe discovery of the human immunodeficiency virus (formerly known as HTLV-III/LAV) as the causative agent of the acquired immunodeficiency syndrome (AIDS) has led to the commercial availability of tests to detect antibody to one or more viral coded proteins. The most frequently used method is the enzyme-linked immunosorbent assay (ELISA), and reproducibly reactive tests done with this method are highly specific for antibody to the virus (1). In high-risk populations, such as homosexual men, the human immunodeficiency virus has been isolated from a single blood specimen in 67% to 95% of persons with a positive test for antibody (1, 2)....References1. . Recommendations for assisting in the prevention of perinatal transmission of human T-lymphotropic virus type III/lymphadenopathy-associated virus and acquired immunodeficiency syndrome. MMWR. 1985;34:721-6, 731-2. MedlineGoogle Scholar2. FEORINOJAFFEPALMER PHE. Transfusion-associated acquired immunodeficiency syndrome: evidence for persistent infection in blood donors. N Engl J Med. 1985;312:1293-6. CrossrefMedlineGoogle Scholar3. DIENSTAG J. Immunologic mechanisms in chronic viral hepatitis. In: VYAS GN, DIENSTAG, JL, HOOFNAGLE JH, eds. Viral Hepatitis and Liver Disease. Orlando, Florida: Grune 1984:135-66. Google Scholar4. REICHERTO'LEARYLEVENSSIMRELLMACHER CTDCA. Autopsy pathology in the acquired immune deficiency syndrome. Am J Pathol. 1983;112:357-82. MedlineGoogle Scholar5. RUSTGIHOOFNAGLEGERIN VJJ. Hepatitis B virus infection in the acquired immunodeficiency syndrome. Ann Intern Med. 1984;101:795-7. LinkGoogle Scholar6. GLASGOWANDERSLAYFIELDSTEINSAPIRGITNICKLEWIN BKLKGK. Clinical and pathologic findings of the liver in the acquired immune deficiency syndrome (AIDS). Am J Clin Pathol. 1985;83:582-8. CrossrefMedlineGoogle Scholar7. DOBOZINJUDSONCOHN BFD. The relationship of abnormalities of cellular immunity to antibodies to HTLV III in homosexual men. Cell Immunol. 1986;98:156-71. CrossrefMedlineGoogle Scholar8. NOVICKLOKTHOMAS DAH. Diminished responsiveness of homosexual men to antiviral therapy for HBsAg-positive chronic liver disease. J Hepatol. 1984;1:29-35. CrossrefGoogle Scholar9. PERRILLOGELBCAMPBELL RLC. Hepatitis B e antigen, DNA polymerase activity, and infection of household contacts with hepatitis B virus. Gastroenterology. 1979;76:1319-25. CrossrefMedlineGoogle Scholar10. ALTERSEEFFKAPLAN HLP. Type B hepatitis: the infectivity of blood positive for e antigen and DNA polymerase after accidental needlestick exposure. N Engl J Med. 1976;295:909-13. CrossrefMedlineGoogle Scholar This content is PDF only. To continue reading please click on the PDF icon. Author, Article, and Disclosure InformationAffiliations: PreviousarticleNextarticle Advertisement FiguresReferencesRelatedDetails Metrics Cited ByHepatitis B virus and HIV coinfections can be interpreted in different waysThe Recombinant Hepatitis B Surface Antigen Vaccine in Persons With HIV: Is Seroconversion Sufficient for Long-term Protection?HIV Co-Infection Drug ToxicityHepatitis B in HIV: Available treatment options and approach to therapyAntiretroviral drugs and liver injuryAntiretroviral therapy 2006: Pharmacology, applications, and special situationsHepatotoxicity and antiretroviral therapy with protease inhibitors: A reviewNatural history of chronic hepatitis B in co-infected patientsHepatotoxicity and Nelfinavir: A Meta-AnalysisSurvival in patients with HIV infection and viral hepatitis B or CTreatment of hepatitis B virus infection in patients coinfected with HIVHepatitis B and C viral load changes following initiation of highly active antiretroviral therapy (HAART) in patients with advanced HIV infectionOccult Hepatitis B in HIV-Infected PatientsAntiretroviral Therapy and HIV/Hepatitis B Virus CoinfectionImmunizations, Vaccine-Preventable Diseases, and HIV InfectionAvances en el diagnóstico y tratamiento de la infección por el virus de la hepatitis BManagement of Hepatitis B and C in HIV Co-Infected PatientsTreatment of chronic hepatitis B virus infection in patients co-infected with human immunodeficiency virusInfluence of HIV infection on the response to interferon therapy and the long-term outcome of chronic hepatitis BLack of Hepatotoxicity Associated With Nonnucleoside Reverse Transcriptase InhibitorsManagement of chronic viral hepatitis in HIV-infected patients: Spanish Consensus ConferenceHepatotoxicity associated with nevirapine or efavirenz-containing antiretroviral therapy: Role of hepatitis C and B infectionsLow Frequency of Severe Hepatotoxicity and Association With HCV Coinfection in HIV-Positive Patients Treated With HAARTAcute flares in chronic hepatitis B: The natural and unnatural history of an immunologically mediated liver diseaseRESULTS ON PREEMPTIVE OR PROPHYLACTIC TREATMENT OF LAMIVUDINE IN HBsAg (+) RENAL ALLOGRAFT RECIPIENTS: COMPARISON WITH SALVAGE TREATMENT AFTER HEPATIC DYSFUNCTION WITH HBV RECURRENCEFrecuencia y factores predictivos de hepatotoxicidad en pacientes que reciben terapia antirretroviralHepatitis B and C virus co-infection and the risk for hepatotoxicity of highly active antiretroviral therapy in HIV-1 infectionPrevalence, Patterns, and Course of Past Hepatitis B Virus Infection in Intravenous Drug Users With Hiv-1 InfectionThe Pervalence of Hepatitis B and C in HIV-positive Greek Patients: Relationship to Survival of Deceased AIDS PatientsLong-term incidence of hepatitis B virus resistance to lamivudine in human immunodeficiency virus-infected patientsINTERFERON THERAPY OF HEPATITIS BInfluence of human immunodeficiency virus infection on chronic hepatitis B in homosexual menRetrospective analysis of the impact of HIV infection and alcohol use on chronic hepatitis C in a large cohort of drug usersREVIEW: Present and future directions in the treatment of chronic hepatitis B infectionRISKS OF TRANSPLANTING KIDNEYS FROM HEPATITIS B SURFACE ANTIGEN-NEGATIVE, HEPATITIS B CORE ANTIBODY-POSITIVE DONORS1,2Interactions between HIV and hepatitis B virus in homosexual menCoinfection and Superinfection of Hepatitis B Virus in Patients Infected with Human Immunodeficiency Virus: No Evidence of Faster Progression to AIDSAGA technical review: Malnutrition and cachexia, chronic diarrhea, and hepatobiliary disease in patients with human immunodeficiency virus infectionLong-term effects of interferon-α in five HIV-positive patients with chronic hepatitis BInterferon-α for Viral HepatitisThe Interaction of Human Immunodeficiency Virus Infection and Hepatitis B Virus Infection in Infected Homosexual MenSeroconversion to HBV associated with seroconversion to HIV in a cohort of intravenous drug misusers in Turin, ItalyChronic viral hepatitis and the management of chronic renal failureInterferons for viral hepatitisSustained elimination of hepatitis B virus from serum induced in a patient with chronic hepatitis B and advanced human immunodeficiency virus infectionHepatitis C in HIV-infected patients with and without AIDS: Prevalence and relationship to patient survivalInfluence of human immunodeficiency virus infection on hepatitis δ virus superinfection in chronic HBsAg carriersHepatitis VirusesA comparison of risk factors for human immunodeficiency virus and hepatitis B virus infections in homosexual menValue of liver biopsy in the evaluation and management of chronic liver disease in renal transplant recipientsFoscarnet treatment of chronic hepatitis B in an HIV-positive patientHepatitis B in Patients with HIV Infection: Relationship to AIDS and Patient SurvivalBruce F. Scharschmidt, MD, Michael J. Held, MA, Harry H. Hollander, MD, Alexandra E. Read, MD, Joel E. Lavine, MD, PhD, Genevieve Veereman, MD, Richard F. McGuire, MD, M. Michael Thaler, MDInteractions between human immunodeficiency virus-1, hepatitis delta virus and hepatitis B virus infections in 260 chronic carriers of hepatitis B virusEffect of duration of hepatitis B virus infection on the association between human immunodeficiency virus type-1 and hepatitis B viral replicationSexually transmitted hepatitis: a review.Treatment of chronic type D hepatitis and concomitant human immunodeficiency infection with α-interferonDIAGNOSIS AND TREATMENT OF SUBSTANCE USERS WITH HIV INFECTIONLack of HBV and HDV replicative activity in HBsAg-positive intravenous drug addicts with immune deficiency due to HIVHIV-positive womenRemission of Hepatitis B-Associated Membranous Glomerulonephritis in Human Immunodeficiency Virus InfectionLong-Term Remission of Chronic Hepatitis B after Alpha-Interferon TherapyJulia Korenman, MD, Bennie Baker, MD, PhD, Jeanne Waggoner, BA, James E. Everhart, MD, Adrian M. Di Bisceglie, MD, Jay H. Hoofnagle, MDClinical course of spontaneous reactivation of hepatitis B virus infection in patients with chronic hepatitis BRelationship between histology, aminotransferase levels, and viral replication in chronic hepatitis BHepatitis B: transmission by sexual contact and needle sharingHistological and immunohistochemical study of hepatitis B virus in human immunodeficiency virus infection.Preliminary evidence that azidothymidine does not affect hepatitis B virus replication in acquired immunodeficiency syndrome (AIDS) patientsRapidly progressive non-A, non-B hepatitis in patients with human immunodeficiency virus infectionVaccination against hepatitis B in homosexual menHepatitis in renal transplant recipientsCLINICAL REACTIVATION OF HEPATITIS B IN ANTI-HBs-POSITIVE PATIENTS WITH AIDSHepatitis B virus DNA in serum. Applied molecular biology in the evaluation of hepatitis B infectionHepatobiliary Abnormalities of AIDSHepatitis B Prevention and Human Immunodeficiency Virus (HIV) InfectionStephen C. Hadler, MDPrednisone Withdrawal Followed by Recombinant Alpha Interferon in the Treatment of Chronic Type B Hepatitis A Randomized, Controlled TrialRobert P. Perrillo, MD, Fredric G. Regenstein, MD, Marion G. Peters, MD, Katherine DeSchryver-Kecskemeti, MD, Carol J. Bodicky, RN, Carolyn R. Campbell, BS, Mary C. Kuhns, PhDHepatitisHepatitis B virus and hepatitis B-related viral infection in renal transplant recipientsEffects of HIV superinfection on HBV replication in a chronic HBsAg carrier with liver diseaseAdenine Arabinoside Monophosphate (Vidarabine Phosphate) in Combination with Human Leukocyte Interferon in the Treatment of Chronic Hepatitis B A Randomized, Double-Blinded, Placebo-Controlled TrialGABRIEL GARCIA, M.D., COLEMAN I. SMITH, M.D., JED I. WEISSBERG, M.D., MARK EISENBERG, M.D., JACK BISSETT, M.D., PREM V. NAIR, M.D., BARBARA MASTRE, R.N., SUE ROSNO, R.N., DEBBIE ROSKAMP, R.N., KAREN WATERMAN, R.N., RICHARD B. POLLARD, M.D., MYRON J. TONG, MD., Ph.D., BYRON W. BROWN Jr., Ph.D., WILLIAM S. ROBINSON, M.D., PETER B. GREGORY, M.D., THOMAS C. MERIGAN, M.D.Time for action on hepatitis B immunisation.Hepatitis in renal transplant recipients 1 September 1986Volume 105, Issue 3Page: 382-383KeywordsAIDSChronic hepatitis BEnzyme linked immunosorbent assayHIVHematologic testsHomosexualsPopulation statisticsProteins Issue Published: 1 September 1986 PDF DownloadLoading ...