Rheumatic Fever in Children and Adolescents

Article1 February 1964Rheumatic Fever in Children and AdolescentsVI. Clinical Features of Streptococcal Infections and Rheumatic RecurrencesALVAN R. FEINSTEIN, M.D., MARIO SPAGNUOLO, M.D., HARRISON F. WOOD, M.D., ANGELO TARANTA, M.D., ESTHER TURSKY, R.N., EDITH KLEINBERG, B.S.ALVAN R. FEINSTEIN, M.D., MARIO SPAGNUOLO, M.D., HARRISON F. WOOD, M.D., ANGELO TARANTA, M.D., ESTHER TURSKY, R.N., EDITH KLEINBERG, B.S.Author, Article, and Disclosure Informationhttps://doi.org/10.7326/0003-4819-60-2-68 SectionsAboutPDF ToolsAdd to favoritesDownload CitationsTrack CitationsPermissions ShareFacebookTwitterLinkedInRedditEmail ExcerptWhen a large group of children and adolescents is examined repetitively at monthly intervals after an attack of acute rheumatic fever, three main kinds of clinical events may be anticipated: [1] streptococcal infections, [2] recurrences of rheumatic fever, and [3] changes in cardiac status. A population of 431 young rheumatic patients, in whom these events could be observed, was originally assembled for long-term study of the antistreptococcal and antirheumatic effectiveness of three prophylactic regimens. The results of the prophylaxis study, and some selected correlations of the recurrent streptococcal and rheumatic inflammation, have been reported elsewhere (1-5).Despite the continuous use...References1. WOODSIMPSONFEINSTEINTARANTASTOLLERMAN HFRARAGH: Rheumatic fever in children and adolescents: A long-term Epidemiologic study of subsequent prophylaxis, streptococcal infections, and clinical Sequelae. I. Description of the investigative techniques and of the population studied. Ann. Intern. Med. (Feb. Supp.): 6, 1964. LinkGoogle Scholar2. GAVRINTURSKYALBAMFEINSTEIN JBEBAR: Ibid. II. Maintenance and preservation of the population. Ibid., p. 18. Google Scholar3. WOODFEINSTEINTARANTAEPSTEINSIMPSON HFARAJR: Ibid. III. Comparative effectiveness of three prophylaxis regimens in preventing streptococcal infections and rheumatic recurrences. P. 31. Google Scholar4. TARANTAWOODFEINSTEINSIMPSONKLEINBERG AHFARRE: Ibid. IV. Relationship of the rheumatic fever recurrence rate per streptococcal infection to the titers of streptococcal antibodies. P. 47. Google Scholar5. TARANTAKLEINBERGFEINSTEINWOODTURSKYSIMPSON AEARHFER: Ibid. V. Relationship of the rheumatic fever recurrence rate per streptococcal infection to pre-existing clinical features of the patients. P. 58. Google Scholar6. FEINSTEINWOODSPAGNUOLOTARANTAJONASKLEINBERGTURSKY ARHFMASEE: Ibid. VII. Cardiac changes and Sequelae. P. 87. Google Scholar7. : Report of committee on standards and criteria for programs of care of the council on rheumatic fever: Jones criteria (modified) for guidance in diagnosis of rheumatic fever. Mod. Conc. Cardiov. Dis. 24: 291, 1955. MedlineGoogle Scholar8. JOHNSONSTOLLERMANGROSSMANMCCULLOCH EEGHBJH: Streptococcal infections in adolescents and adults after prolonged freedom from rheumatic fever. I. Results of the first three years of the study. New Eng. J. Med. 263: 105, 1960. CrossrefMedlineGoogle Scholar9. MILLERSTANCERMASSELL JMSLBF: A controlled study of beta hemolytic streptococcal infection in rheumatic families. I. Streptococcal disease among healthy siblings. Amer. J. Med. 25: 825, 1958. CrossrefMedlineGoogle Scholar10. ZAGALAFEINSTEIN JGAR: The preceding illness of acute rheumatic fever. JAMA 179: 863, 1962. CrossrefMedlineGoogle Scholar11. SPAGNUOLOFEINSTEIN MAR: Rheumatic activity and congestive heart failure in young patients with rheumatic heart disease (abstract). Clin. Res. 9: 150, 1961. Complete report in press (Pediatrics). Google Scholar12. WANNAMAKER LW: The paradox of the antibody response to streptodornase. The usefulness of antidesoxyribonuclease B as an indication of streptococcal infection in patients with acute rheumatic fever. Amer. J. Med. 27: 567, 1959. CrossrefMedlineGoogle Scholar13. FEINSTEINSPAGNUOLO ARM: Mimetic features of rheumatic fever recurrences. New Eng. J. Med. 262: 533, 1960. CrossrefMedlineGoogle Scholar14. FEINSTEINSPAGNUOLO ARM: The clinical patterns of acute rheumatic fever: a reappraisal. Medicine 41: 279, 1962. CrossrefMedlineGoogle Scholar15. MADSENKALBAK TK: Investigations on rheumatic fever subsequent to some epidemics of septic sore throat (especially milk epidemics). Acta Path. Microbiol. Scand. 17: 305, 1940. CrossrefGoogle Scholar16. RAMMELKAMPWANNAMAKERDENNY CHLWFW: The epidemiology and prevention of rheumatic fever. Bull. NY Acad. Med. 28: 321, 1952. MedlineGoogle Scholar17. SIEGELJOHNSONSTOLLERMAN ACEEGH: Controlled studies of streptococcal pharyngitis in a pediatric population. I. Factors related to the attack rate of rheumatic fever. New Eng. J. Med. 265: 559, 1961. CrossrefGoogle Scholar18. PIKEFASHENA RMGJ: Frequency of hemolytic streptococci in the throats of well children in Dallas. Amer. J. Public Health 36: 600, 1946. CrossrefGoogle Scholar19. QUINNMARTIN RWMP: The natural occurrence of hemolytic streptococci in school children. A five-year study. Amer. J. Hyg. 73: 193, 1961. MedlineGoogle Scholar20. CORNFELDHUBBARD DJP: A four-year study of the occurrence of beta-hemolytic streptococci in 64 school children. New Eng. J. Med. 264: 211, 1961. CrossrefMedlineGoogle Scholar21. SASLAWSTREITFELD MSMM: Group A beta hemolytic streptococci in relation to rheumatic fever. Study of school children in Miami, mia. Fla. Amer. J. Dis. Child. 92: 550, 1956. CrossrefMedlineGoogle Scholar22. STREITFELDSASLAW MMMS: Beta hemolytic streptococci and rheumatic fever in Miami, Fla. II. Antistreptolysin O titer determinations between Oct. 1954 and May, 1955. Dis. Chest 37: 211, 1960. CrossrefMedlineGoogle Scholar23. PAUL JR: The Epidemiology of Rheumatic Fever, 3rd ed., American Heart Association, 1957. Google Scholar24. RANTZBOISVERTSPINK LAPJWW: Hemolytic streptococcus sore throat. The poststreptococcic state. Arch. Intern. Med. (Chicago) 79: 401, 1947. CrossrefGoogle Scholar25. HOUSERECKHARDTHAHNDENNYWANNAMAKERRAMMELKAMP HBGCEOFWLWCH: Effect of aureomycin treatmentof streptococcal sore throat on streptococcal carrier state, immunologic response of host, and incidence of acute rheumatic fever. Pediatrics 12: 593, 1953. MedlineGoogle Scholar26. CATANZAROSTETSONMORRISCHAMOVITZRAMMELKAMPSTOLZERPERRY FJCAAJRCHBLWD: The role of the streptococcus in the pathogenesis of rheumatic fever. Amer. J. Med. 17: 749, 1954. CrossrefMedlineGoogle Scholar27. RAMMELKAMPSTOLZER CRBL: The latent period before the onset of acute rheumatic fever. Yale J. Biol. Med. 34: 386, 1961-1962. MedlineGoogle Scholar28. RANTZ LA: The streptococcal etiology of rheumatic fever. Med. Clin. N. Amer. 39: 339, 1955. CrossrefGoogle Scholar29. STOLLERMANLEWISSCHULTZTARANTA GHAJIA: Relationship of immune response to group A streptococci to the course of acute, chronic and recurrent rheumatic fever. Amer. J. Med. 20: 163, 1956. CrossrefMedlineGoogle Scholar30. ROTHLINGGWHITTEMORE IRCA: Certain aspects of the age of onset and of recurrences in 488 cases of juvenile rheumatism ushered in by major clinical manifestations. Amer. Heart J. 13: 36, 1937. CrossrefGoogle Scholar31. BOONELEVINE JASA: The prognosis in "potential rheumatic heart disease" and "rheumatic mitral insufficiency." Amer. J. Med. Sci. 195: 764, 1938. CrossrefGoogle Scholar32. BROWNWOLFF MGL: Recovery from acute rheumatic fever without permanent heart damage. New Eng. J. Med. 223: 242, 1940. CrossrefGoogle Scholar33. BROWN MG: Acute rheumatic fever and valvular damage. Amer. Heart J. 25: 686, 1943. CrossrefGoogle Scholar34. ENGELMANHOLLISTERKOLB EPLEFO: Sequelae of rheumatic fever in men. 4 to 8 year follow-up study. JAMA 155: 1134, 1954. CrossrefMedlineGoogle Scholar35. KUTTNERMAYER AGFE: Carditis during second attacks of rheumatic fever: Its incidence in patients without clinical evidence of cardiac involvement in their initial rheumatic episode. New Eng. J. Med. 268: 1259, 1963. CrossrefGoogle Scholar36. ASH R: Rheumatic infection in childhood: influence of type of onset and calendar year of onset. Amer. Heart J. 22: 439, 1941. CrossrefGoogle Scholar37. ASH R: The first 10 years of rheumatic infection in childhood. Amer. Heart J. 36: 89, 1948. CrossrefMedlineGoogle Scholar38. BLANDWHITEJONES EFPDTD: The development of mitral stenosis in young people. Amer. Heart J. 10: 995, 1935. CrossrefGoogle Scholar39. BLANDJONES EFTD: The delayed appearance of heart disease after rheumatic fever. JAMA 113: 1380, 1939. CrossrefGoogle Scholar40. BLANDJONES EFTD: Rheumatic fever and heart disease: a twenty year report on 1,000 patients followed since childhood. Circulation 4: 836, 1951. CrossrefMedlineGoogle Scholar41. FEINSTEIN AR: The stethoscope: a source of diagnostic aid and conceptual errors in rheumatic heart disease. J. Chron. Dis. 11: 91, 1960. CrossrefMedlineGoogle Scholar42. FEINSTEIN AR: Standards, stethoscopes, steroids and statistics. The problem of evaluating treatment in acute rheumatic fever. Pediatrics 27: 819, 1961. MedlineGoogle Scholar43. FINDLAY L: The Rheumatic Infection in Childhood, Wm. Wood, New York, 1932. Google Scholar44. KUSKINSIEGEL LM: The changing pattern of rheumatic heart disease. J. Pediat. 49: 574, 1956. CrossrefMedlineGoogle Scholar45. GUASCHVIGNAUMORTIMERRAMMELKAMP LJIAEACH: Studies of the role of continuing or recurrent streptococcal infection in rheumatic valvular heart disease. Amer. J. Med. Sci. 244: 290, 1962. CrossrefMedlineGoogle Scholar This content is PDF only. To continue reading please click on the PDF icon. Author, Article, and Disclosure InformationAffiliations: Irvington-on-Hudson, New YorkFrom Irvington House, Irvington-on-Hudson, New York, and the Departments of Medicine and Pediatrics, New York University School of Medicine, New York.This work was supported in part by the National Heart Institute grant H-1595 (C-1-8), American Heart Association, New York Heart Association, Westchester Heart Association, and Wyeth Laboratories.Drs. Feinstein and Wood are currently with the Department of Internal Medicine and the Department of Pediatrics, respectively, Yale University School of Medicine, New Haven, Connecticut.Requests for reprints should be addressed to Alvan R. Feinstein, M.D., Department of Internal Medicine, Yale University School of Medicine, 333 Cedar Street, New Haven 11, Connecticut. PreviousarticleNextarticle Advertisement FiguresReferencesRelatedDetails Metrics Cited byClinical Evaluation and Diagnosis of Acute Rheumatic FeverClinical Evaluation and Diagnosis of Rheumatic Heart DiseaseTHE PREVALENCE OF CLINICAL AND SUBCLINICAL RHEUMATIC HEART DISEASE (RHD) DIAGNOSED BY COLOUR DOPPLER ECHOCARDIOGRAPHY USING WORLD HEART FEDERATION (WHF) CRITERIA IN 5-15 YEARS OLD SCHOOL GOING CHILDREN OF A NORTHEASTERN INDIAN STATE (MANIPUR)Rheumatic heart disease screening: Current concepts and challengesRheumatic Fever and Rheumatic Heart DiseaseLatent Rheumatic Heart Disease: Outcomes 2 Years After Echocardiographic DetectionIncreasing detection of rheumatic heart disease with echocardiographyWorld Heart Federation criteria for echocardiographic diagnosis of rheumatic heart disease—an evidence-based guidelineOnce weekly azithromycin in secondary prevention of rheumatic feverAcute rheumatic feverRheumatic Valvular DiseaseRheumatic FeverThe diagnosis of rheumatic fever — evolution of the Jones criteriaREFERENCESStreptococcal Infections—The Pharmacist's ResponsibilitiesRisk of Rheumatic-Fever Recurrences after Streptococcal InfectionsClinical effects of recurrent attacks of acute rheumatic fever: a prospective epidemiologic study of 105 episodesProphylaxis of bacterial disease with antimicrobial drugsThe prognosis of acute rheumatic feverScientific Methodology in Clinical Medicine II. Classification of Human Disease by Clinical BehaviorALVAN R. FEINSTEIN, M.D.Rheumatic Fever in Children and Adolescents A Long-term Epidemiologic Study of Subsequent Prophylaxis, Streptococcal Infections, and Clinical Sequelae V. Relation of the Rheumatic Fever Recurrence Rate per Streptococcal Infection to Pre-existing Clinical Features of the PatientsANGELO TARANTA, M.D., EDITH KLEINBERG, B.S., ALVAN R. FEINSTEIN, M.D., HARRISON F. WOOD, M.D., ESTHER TURSKY, R.N., RITA SIMPSON, B.A. 1 February 1964Volume 60, Issue 2_Part_2Page: 68-86KeywordsAdolescentsChildrenHeartInflammationPediatricsProphylaxisRheumatic feverStreptococcal infections Issue Published: 1 February 1964 PDF downloadLoading ...